Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-31 (HV431)

This Recombinant Human Immunoglobulin heavy variable 4-31 (HV431) spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-31 IGHV4-31

UniProt

P0DP07

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSQTLSLTCTVSGGSISSGGYYWSWIRQHPGKGLEWIGYIYYSGSTYYNPSLKSLVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZFluor™ 633 succinimidyl ester
1510-AAT 1 mg

ZFluor™ 633 succinimidyl ester

Sign In for Pricing
View Details
TNFRSF10B Antibody
KC-2033-01 50 μL

TNFRSF10B Antibody

Sign In for Pricing
View Details
TNFRSF10B Antibody
KC-2033-02 100 µL

TNFRSF10B Antibody

Sign In for Pricing
View Details
TNFRSF10B Antibody
KC-2033-03 1 mL

TNFRSF10B Antibody

Sign In for Pricing
View Details
Synaptotagmin 3 (SYT3) (NM_001160329) Human Over-expression Lysate
LY431997 100 µg

Synaptotagmin 3 (SYT3) (NM_001160329) Human Over-expression Lysate

Sign In for Pricing
View Details
Human ATG4D activation kit by CRISPRa
GA113811 1 Kit

Human ATG4D activation kit by CRISPRa

Sign In for Pricing
View Details