Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-38-2 (HVD82)

This Recombinant Human Immunoglobulin heavy variable 4-38-2 (HVD82) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-38-2 IGHV4-38-2

UniProt

P0DP08

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSETLSLTCTVSGYSISSGYYWGWIRQPPGKGLEWIGSIYHSGSTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-Chk1  (Ser296)  Antibody
ABF3004 100 µg

Phospho-Chk1 (Ser296) Antibody

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Copper-exporting P-type ATPase A (copA), partial
MBS1082395-01 1 mg (E-Coli)

Recombinant Staphylococcus aureus Copper-exporting P-type ATPase A (copA), partial

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Copper-exporting P-type ATPase A (copA), partial
MBS1082395-02 1 mg (Yeast)

Recombinant Staphylococcus aureus Copper-exporting P-type ATPase A (copA), partial

Sign In for Pricing
View Details
Anti-CDCP1 Antibody Picoband® (HRP Conjugate)
PB9933-HRP 100 µg/Vial

Anti-CDCP1 Antibody Picoband® (HRP Conjugate)

Sign In for Pricing
View Details
GRP94 (HSP90B1) Human shRNA Plasmid Kit (Locus ID 7184)
TR312309 1 Kit

GRP94 (HSP90B1) Human shRNA Plasmid Kit (Locus ID 7184)

Sign In for Pricing
View Details
Neuraminidase (NEU1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3B8]
TA801671BM 100 µL

Neuraminidase (NEU1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3B8]

Sign In for Pricing
View Details