Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1-13 (KV113)

This Recombinant Human Immunoglobulin kappa variable 1-13 (KV113) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1-13 IGKV1-13

UniProt

P0DP09

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AIQLTQSPSSLSASVGDRVTITCRASQGISSALAWYQQKPGKAPKLLIYDASSLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQFNSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

p53 (TP53) pThr18 Rabbit Polyclonal Antibody
AP08002PU-N 100 µL

p53 (TP53) pThr18 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
UGT2B15 (Center) Rabbit Polyclonal Antibody
AP54455PU-N 400 µL

UGT2B15 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CORO7 (NM_024535) Human Recombinant Protein
TP324038 20 µg

CORO7 (NM_024535) Human Recombinant Protein

Sign In for Pricing
View Details
Human MAGED2 activation kit by CRISPRa
GA107485 1 Kit

Human MAGED2 activation kit by CRISPRa

Sign In for Pricing
View Details
TAG-72 / CA72.4 (Tumor-Associated Glycoprotein) (rB72.3), CF568 conjugate, 0.1mg/mL
BNC683177-500 1x 500 µL

TAG-72 / CA72.4 (Tumor-Associated Glycoprotein) (rB72.3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2-[(p-Aminophenyl)sulphonyl]-3-chloropyrazine
TRC-A771650-500MG 500 mg

2-[(p-Aminophenyl)sulphonyl]-3-chloropyrazine

Sign In for Pricing
View Details