Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1-13 (KV113)

This Recombinant Human Immunoglobulin kappa variable 1-13 (KV113) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1-13 IGKV1-13

UniProt

P0DP09

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AIQLTQSPSSLSASVGDRVTITCRASQGISSALAWYQQKPGKAPKLLIYDASSLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQFNSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pomalidomide-(d4 major)
TRC-P688202-2.5MG 2.5 mg

Pomalidomide-(d4 major)

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB505317 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
FOXC2 Human Gene Knockout Kit (CRISPR)
KN423412 1 Kit

FOXC2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS712456 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
SNPH Human Gene Knockout Kit (CRISPR)
KN207749RB 1 Kit

SNPH Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FAM48A (SUPT20H) (NM_001014286) Human Over-expression Lysate
LC423050 20 µg

FAM48A (SUPT20H) (NM_001014286) Human Over-expression Lysate

Sign In for Pricing
View Details