Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human V-set and immunoglobulin domain-containing protein 10-like 2 (VSXL2), partial

This Recombinant Human V-set and immunoglobulin domain-containing protein 10-like 2 (VSXL2), partial spans the amino acid sequence from region 29-703. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

V-set and immunoglobulin domain-containing protein 10-like 2 VSIG10L2

UniProt

P0DP72

Expression Region

29-703

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QPHPTPEAPVEEVVSVQGVRGGSVELACGSGPAPLLVLWSFTPLGSLVPRPVAVTDGAMSKVEAIASALGVVSLRNSSLVLGELHEGARGHFLCQVLHVAGGQLHAAYSHLTLAVLVPVSKPQVRLSNPSPVEGASVVATCAVREGTEPVTFAWQHRAPRGLGEALVGVTEPLFQLDPVNRTHLGWYMCSASNSVNRLSSDGAFLDVIYGPDKPVITMEPLGLTEEGFWASEREEVTLSCLAASNPPSHYVWLRDHTQVHTGPTYVIARAGRVHTGLYTCLARNSYLDTRTQTTVQLTIYYPPEGQPSCAVHPSPEAVTLLCAWPGGLPPAQLQWEGPQGPGPTAPSNVTWSHAAAQLPSGSVFTCTGQHPALAPPALCTVMLWEPLGRPTCWSTATMGDQFIMLSCEWPGGEPPATLGWLDEQQQPLGGSSSSMAVHLLQAQEDLAGREFTCRGTHLLRTPDPHCHLQLEAPQLDVAEPRVSVLEGGEAWLECSLRGGTPPAQLLWLGPQQQKVDPGTSGFMLHPEGAQLRLGIYDADPAHHRGTYQCVARNAVGNSSQSVLLEVLRYPAPPNVTISRLTYGRHRREVQLQWAILGPGNLTGFLVQRKASALGPGAGAWETAASDIEPESRGRRLGGLDPGVLYAFRILALNHHTAGHPSEVKIPADPPFSAYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Syntaxin 8 (STX8) ELISA Kit
YLA3247HU-01 48 Tests

Human Syntaxin 8 (STX8) ELISA Kit

Sign In for Pricing
View Details
Human Syntaxin 8 (STX8) ELISA Kit
YLA3247HU-02 96 Tests

Human Syntaxin 8 (STX8) ELISA Kit

Sign In for Pricing
View Details
MTCH1 (h) -PR
sc-95477-PR 10 µM - 20 µL

MTCH1 (h) -PR

Sign In for Pricing
View Details
Recombinant Oenococcus oeni Ribonuclease P protein component (rnpA)
MBS1244031-01 0.02 mg (E-Coli)

Recombinant Oenococcus oeni Ribonuclease P protein component (rnpA)

Sign In for Pricing
View Details
Recombinant Oenococcus oeni Ribonuclease P protein component (rnpA)
MBS1244031-02 0.1 mg (E-Coli)

Recombinant Oenococcus oeni Ribonuclease P protein component (rnpA)

Sign In for Pricing
View Details
Recombinant Oenococcus oeni Ribonuclease P protein component (rnpA)
MBS1244031-03 0.02 mg (Yeast)

Recombinant Oenococcus oeni Ribonuclease P protein component (rnpA)

Sign In for Pricing
View Details