Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Beta-defensin 130A (D130A)

This Recombinant Human Beta-defensin 130A (D130A) spans the amino acid sequence from region 23-79. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Beta-defensin 130A; Beta-defensin 130; Beta-defensin 30; DEFB-30; Defensin, beta 130; DEFB130A DEFB130 DEFB30

UniProt

P0DP74

Expression Region

23-79

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVIPGQKQCIALKGVCRDKLCSTLDDTIGICNEGKKCCRRWWILEPYPTPVPKGKSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC/iFluor® 700 Anti-mouse CD105 Antibody *MJ7/18*
110501E0-AAT 25 Tests

APC/iFluor® 700 Anti-mouse CD105 Antibody *MJ7/18*

Sign In for Pricing
View Details
Avutometinib
bs-83753C-01 5 mg

Avutometinib

Sign In for Pricing
View Details
Avutometinib
bs-83753C-02 25 mg

Avutometinib

Sign In for Pricing
View Details
Rat MGP Matched Antibody Pair Set [ABP-S-03857]
ABP-S-03857 5 Plates

Rat MGP Matched Antibody Pair Set [ABP-S-03857]

Sign In for Pricing
View Details
Human GOLGA2 (Golgin Subfamily A Member 2) ELISA Kit
EK240204 96 Well

Human GOLGA2 (Golgin Subfamily A Member 2) ELISA Kit

Sign In for Pricing
View Details
Capmatinib (dihydrochloride)
HY-13404A-01 5 mg

Capmatinib (dihydrochloride)

Sign In for Pricing
View Details