Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 35 (TVA35)

This Recombinant Human T cell receptor alpha variable 35 (TVA35) spans the amino acid sequence from region 20-110. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 35 TRAV35

UniProt

P0DPF4

Expression Region

20-110

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQLNQSPQSMFIQEGEDVSMNCTSSSIFNTWLWYKQEPGEGPVLLIALYKAGELTSNGRLTAQFGITRKDSFLNISASIPSDVGIYFCAGQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JTB Overexpression Lysate (Native) - (Dry Ice)
NBL1-12112 0.1 mg

JTB Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
[Lys8, Lys9]-Neurotensin (8-13)
5-00237 4x 5 mg

[Lys8, Lys9]-Neurotensin (8-13)

Sign In for Pricing
View Details
Olfr1312 Recombinant Protein (Mouse)
RP156698 100 µg

Olfr1312 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
CLCN3 Antibody
MBS8516988-01 0.05 mg

CLCN3 Antibody

Sign In for Pricing
View Details
CLCN3 Antibody
MBS8516988-02 0.1 mg

CLCN3 Antibody

Sign In for Pricing
View Details
CLCN3 Antibody
MBS8516988-03 0.1 mL (AF750)

CLCN3 Antibody

Sign In for Pricing
View Details