Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Glutamine amidotransferase-like class 1 domain-containing protein 3, mitochondrial (GAL3A)

This Recombinant Human Glutamine amidotransferase-like class 1 domain-containing protein 3, mitochondrial (GAL3A) spans the amino acid sequence from region 42-268. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Glutamine amidotransferase-like class 1 domain-containing protein 3, mitochondrial GATD3 C21orf33 GATD3A

UniProt

P0DPI2

Expression Region

42-268

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AARVALVLSGCGVYDGTEIHEASAILVHLSRGGAEVQIFAPDVPQMHVIDHTKGQPSEGESRNVLTESARIARGKITDLANLSAANHDAAIFPGGFGAAKNLSTFAVDGKDCKVNKEVERVLKEFHQAGKPIGLCCIAPVLAAKVLRGVEVTVGHEQEEGGKWPYAGTAEAIKALGAKHCVKEVVEAHVDQKNKVVTTPAFMCETALHYIHDGIGAMVRKVLELTGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (VU-1D9), CF594 conjugate, 0.1mg/mL
BNC940017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF647 conjugate, 0.1mg/mL
BNC471050-100 1x 100 µL

CD3e (CRIS-7), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF405S conjugate, 0.1mg/mL
BNC040977-100 1x 100 µL

TGF-beta (1D11.16.8), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF488A conjugate, 0.1mg/mL
BNC880158-500 1x 500 µL

Cytokeratin 17 (E3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF568 conjugate, 0.1mg/mL
BNC680226-500 1x 500 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Napsin A (Lung Adenocarcinoma Marker) (rNAPSA/1239), CF405S conjugate, 0.1mg/mL
BNC041880-100 1x 100 µL

Napsin A (Lung Adenocarcinoma Marker) (rNAPSA/1239), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details