Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Neuropeptide Y receptor type 4-2 (NPY42), partial

This Recombinant Human Neuropeptide Y receptor type 4-2 (NPY42), partial spans the amino acid sequence from region 1-39. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Neuropeptide Y receptor type 4-2 NPY4R2

UniProt

P0DQD5

Expression Region

1-39

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MNTSHLLALLLPKSPQGENRSKPLGTPYNFSEHCQDSVD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

p-Anisaldehyde Propylene Glycol Acetal-d3
TRC-A673212-2.5MG 2.5 mg

p-Anisaldehyde Propylene Glycol Acetal-d3

Sign In for Pricing
View Details
Frozen Tissue Sections, Stomach
CS627368 5x 5 µm

Frozen Tissue Sections, Stomach

Sign In for Pricing
View Details
Mouse TF (Tissue factor) ELISA Kit
E-EL-M1163-01 24 Tests

Mouse TF (Tissue factor) ELISA Kit

Sign In for Pricing
View Details
Mouse TF (Tissue factor) ELISA Kit
E-EL-M1163-02 48 Tests

Mouse TF (Tissue factor) ELISA Kit

Sign In for Pricing
View Details
Mouse TF (Tissue factor) ELISA Kit
E-EL-M1163-03 96 Tests

Mouse TF (Tissue factor) ELISA Kit

Sign In for Pricing
View Details
CDC25C (NM_001790) Human Over-expression Lysate
LY419747 100 µg

CDC25C (NM_001790) Human Over-expression Lysate

Sign In for Pricing
View Details