Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulinn kappa variable 1D-37 (KVD37)

This Recombinant Human Probable non-functional immunoglobulinn kappa variable 1D-37 (KVD37) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulinn kappa variable 1D-37 IGKV1D-37

UniProt

P0DSN7

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIQLTQSPSSLSASVGDRVTITCRVSQGISSYLNWYRQKPGKVPKLLIYSASNLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYGQRTYNAP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIK3R3 Antibody
63-351 400 µL

PIK3R3 Antibody

Sign In for Pricing
View Details
GRB2 siRNA (Human)
CRH1939-01 15 nmol

GRB2 siRNA (Human)

Sign In for Pricing
View Details
GRB2 siRNA (Human)
CRH1939-02 30 nmol

GRB2 siRNA (Human)

Sign In for Pricing
View Details
LRRCC1 Lentiviral Activation Particles (h)
sc-413781-LAC 200 µL

LRRCC1 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Recombinant Human SYCE1 Protein
E30P03541A 50 µg

Recombinant Human SYCE1 Protein

Sign In for Pricing
View Details
Recombinant Human Protein Wnt-4 (WNT4)
RPC22234-01 20 µg

Recombinant Human Protein Wnt-4 (WNT4)

Sign In for Pricing
View Details