Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulinn kappa variable 1D-37 (KVD37)

This Recombinant Human Probable non-functional immunoglobulinn kappa variable 1D-37 (KVD37) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulinn kappa variable 1D-37 IGKV1D-37

UniProt

P0DSN7

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIQLTQSPSSLSASVGDRVTITCRVSQGISSYLNWYRQKPGKVPKLLIYSASNLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYGQRTYNAP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human LDLRAD4 Pre-designed siRNA Set A
SI008632A 1 Each

Human LDLRAD4 Pre-designed siRNA Set A

Sign In for Pricing
View Details
MAZ (NM_002383) Human Over-expression Lysate
LH06160V 100 µg

MAZ (NM_002383) Human Over-expression Lysate

Sign In for Pricing
View Details
ARF, p14 (p16beta) (BSA & Azide Free) (MaxLight 490)
MBS6463906-01 0.1 mL

ARF, p14 (p16beta) (BSA & Azide Free) (MaxLight 490)

Sign In for Pricing
View Details
ARF, p14 (p16beta) (BSA & Azide Free) (MaxLight 490)
MBS6463906-02 5x 0.1 mL

ARF, p14 (p16beta) (BSA & Azide Free) (MaxLight 490)

Sign In for Pricing
View Details
Timolol Maleate
S4123-10mM/1mL 10 mM/1mL

Timolol Maleate

Sign In for Pricing
View Details
Myoglobin (MYO) BioAssayTM ELISA Kit (Guinea pig)
357505-01 48 Tests

Myoglobin (MYO) BioAssayTM ELISA Kit (Guinea pig)

Sign In for Pricing
View Details