Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 3-38-3 (HV383)

This Recombinant Human Probable non-functional immunoglobulin heavy variable 3-38-3 (HV383) spans the amino acid sequence from region 20-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 3-38-3 IGHV3-38-3 IGHV3-D

UniProt

P0DTE1

Expression Region

20-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESRGVLVQPGGSLRLSCAASGFTVSSNEMSWVRQAPGKGLEWVSSISGGSTYYADSRKGRFTISRDNSKNTLHLQMNSLRAEDTAVYYCKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GP2 Antibody
orb1285206 100 µL

GP2 Antibody

Sign In for Pricing
View Details
TFR (Transferrin Receptor) Mouse ELISA Kit
H5504 96 Tests

TFR (Transferrin Receptor) Mouse ELISA Kit

Sign In for Pricing
View Details
PPP2R2C CytoSection
TS424154P5 25 Slides

PPP2R2C CytoSection

Sign In for Pricing
View Details
IGLV9-49 sgRNA CRISPR Lentivector (Human) (Target 2)
K1068903 1.0 µg DNA

IGLV9-49 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
P40001-100µL Ab RB P- CaM KINASE II (Thr286)*
P40001-100uL 100 µL

P40001-100µL Ab RB P- CaM KINASE II (Thr286)*

Sign In for Pricing
View Details
GLUD1P8 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV726768 1.0 µg DNA

GLUD1P8 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details