Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 8-51-1 (HV511)

This Recombinant Human Probable non-functional immunoglobulin heavy variable 8-51-1 (HV511) spans the amino acid sequence from region 18-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 8-51-1 IGHV8-51-1

UniProt

P0DTE2

Expression Region

18-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EAQLTESGGDLVHLEGPLRLSCAASWFTFSIYEIHWVCQASGKGLEWVAVIWRGESHQYNADYVRGRLTTSRDNTKYMLYMQMISLRTQNMAAFNCAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Peritoneal Mesothelial Cell Complete Medium
CM-H180-01 100 mL

Human Peritoneal Mesothelial Cell Complete Medium

Sign In for Pricing
View Details
Human Peritoneal Mesothelial Cell Complete Medium
CM-H180-02 4x 125 mL

Human Peritoneal Mesothelial Cell Complete Medium

Sign In for Pricing
View Details
Integrin beta1, Adhesion Stimulating (MaxLight 490) discontinued
I7661-38H-ML490 100 µL

Integrin beta1, Adhesion Stimulating (MaxLight 490) discontinued

Sign In for Pricing
View Details
FGA Antibody
E311040 200 µL

FGA Antibody

Sign In for Pricing
View Details
PHLDA3 Human Pre-designed siRNA Set A
HY-RS10444 1 Set

PHLDA3 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Recombinant Rhodospirillum molischianum Light-harvesting protein B-800/850 beta 1 chain (B1), partial
MBS1172177-01 1 mg (E-Coli)

Recombinant Rhodospirillum molischianum Light-harvesting protein B-800/850 beta 1 chain (B1), partial

Sign In for Pricing
View Details