Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 276 (TM276), partial

This Recombinant Human Transmembrane protein 276 (TM276), partial spans the amino acid sequence from region 135-192. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transmembrane protein 276 TMEM276

UniProt

P0DTL5

Expression Region

135-192

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ANTYGMWGGAMLGVAGLLSRLEEDRLLLLPKEDVCRWALAVGSWAYCRALHTQRLQWE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (NGFR/1964), CF740 conjugate, 0.1mg/mL
BNC741964-500 1x 500 µL

NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (NGFR/1964), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Col17a1 Rabbit Polyclonal Antibody
AP23435PU-N 100 µg

Col17a1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2-Iminopiperidine, Hydrochloride
TRC-I435000-1G 1 g

2-Iminopiperidine, Hydrochloride

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS501571 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Human PTRHD1 activation kit by CRISPRa
GA118212 1 Kit

Human PTRHD1 activation kit by CRISPRa

Sign In for Pricing
View Details
MYST2 Antibody
8C10221-AAT 50 µg

MYST2 Antibody

Sign In for Pricing
View Details