Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 276 (TM276), partial

This Recombinant Human Transmembrane protein 276 (TM276), partial spans the amino acid sequence from region 135-192. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transmembrane protein 276 TMEM276

UniProt

P0DTL5

Expression Region

135-192

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ANTYGMWGGAMLGVAGLLSRLEEDRLLLLPKEDVCRWALAVGSWAYCRALHTQRLQWE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MOK (MAPK/MAK/MRK Overlapping Kinase, MOK Protein Kinase, Renal Tumor Antigen 1, RAGE1 RAGE-1, RAGE) (MaxLight 650)
129792-ML650 100 µL

MOK (MAPK/MAK/MRK Overlapping Kinase, MOK Protein Kinase, Renal Tumor Antigen 1, RAGE1 RAGE-1, RAGE) (MaxLight 650)

Sign In for Pricing
View Details
Akr1cl Protein Vector (Mouse) (pPM-C-His)
PV153657 500 ng

Akr1cl Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
ID2 Rabbit Polyclonal Antibody (Cy5.5)
orb1047701 100 µL

ID2 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
St8sia3 Mouse qPCR Primer Pair (NM_009182)
MP216242 200 Reactions

St8sia3 Mouse qPCR Primer Pair (NM_009182)

Sign In for Pricing
View Details
ZNF236 Antibody - C-terminal region : HRP (ARP38936_P050-HRP)
ARP38936_P050-HRP 100 µL

ZNF236 Antibody - C-terminal region : HRP (ARP38936_P050-HRP)

Sign In for Pricing
View Details
[2- (3-Aminophenyl) ethyl]carbamic acid tert-butyl ester
260973-01 50 mg

[2- (3-Aminophenyl) ethyl]carbamic acid tert-butyl ester

Sign In for Pricing
View Details