Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Splicing regulatory small protein (SRSP)

This Recombinant Human Splicing regulatory small protein (SRSP) spans the amino acid sequence from region 1-130. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Splicing regulatory small protein SRSP

UniProt

P0DXC1

Expression Region

1-130

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MRTKPQRPRATRSYLGQPCGSPRRTEETGETWERVAFSLFTHTCTQPLAGTVDTHLPSLLLPVILHPLGAASAGRALEPKADPHTCPYGRKESRGEKVRRGRAKSNSGPNVPGPPAAPQSLKSGSPSTRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human PIAS2 Polyclonal Antibody
PHB35901 100 μg

Anti-Human PIAS2 Polyclonal Antibody

Sign In for Pricing
View Details
TFAP2A, CT (Transcription Factor AP-2-alpha, AP2-alpha, Activating Enhancer-Binding Protein 2 alpha, AP-2 Transcription Factor, Activator Protein 2, AP-2, AP2TF, TFAP2) (MaxLight 750)
MBS6503310-01 0.1 mL

TFAP2A, CT (Transcription Factor AP-2-alpha, AP2-alpha, Activating Enhancer-Binding Protein 2 alpha, AP-2 Transcription Factor, Activator Protein 2, AP-2, AP2TF, TFAP2) (MaxLight 750)

Sign In for Pricing
View Details
TFAP2A, CT (Transcription Factor AP-2-alpha, AP2-alpha, Activating Enhancer-Binding Protein 2 alpha, AP-2 Transcription Factor, Activator Protein 2, AP-2, AP2TF, TFAP2) (MaxLight 750)
MBS6503310-02 5x 0.1 mL

TFAP2A, CT (Transcription Factor AP-2-alpha, AP2-alpha, Activating Enhancer-Binding Protein 2 alpha, AP-2 Transcription Factor, Activator Protein 2, AP-2, AP2TF, TFAP2) (MaxLight 750)

Sign In for Pricing
View Details
Mouse Npffr1 activation kit by CRISPRa
GA214719 1 Kit

Mouse Npffr1 activation kit by CRISPRa

Sign In for Pricing
View Details
GW788388 500mg
A11083-500 500 mg

GW788388 500mg

Sign In for Pricing
View Details
Anti-TNFRSF8/CD30 Antibody (Brentuximab vedotin)
F1042-50 50 mg

Anti-TNFRSF8/CD30 Antibody (Brentuximab vedotin)

Sign In for Pricing
View Details