Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative Wilms tumor upstream neighbor 1 gene protein (WIT1)

This Recombinant Human Putative Wilms tumor upstream neighbor 1 gene protein (WIT1) spans the amino acid sequence from region 1-92. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative Wilms tumor upstream neighbor 1 gene protein; WIT-1; Wilms tumor-associated antisense RNA; WT1-AS WIT1

UniProt

Q06250

Expression Region

1-92

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MQRRGQPLENHVALIHWQSAGIPASKVHNYCNMKKSRLGRSRAVRISQPLLSPRRCPLHLTERGAGLLQPQPQGPVRTPGPPSGSHPAAADN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF594 conjugate, 0.1mg/mL
BNC941429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF640R conjugate, 0.1mg/mL
BNC400342-100 1x 100 µL

CD43 (84-3C1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF568 conjugate, 0.1mg/mL
BNC680253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF405S conjugate, 0.1mg/mL
BNC040146-100 1x 100 µL

CD10 (CB-CALLA), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF568 conjugate, 0.1mg/mL
BNC682848-500 1x 500 µL

Fibronectin (Fn-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), Biotin conjugate, 0.1mg/mL
BNCB0978-100 1x 100 µL

CD7 (T3-3A1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details