Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative Wilms tumor upstream neighbor 1 gene protein (WIT1)

This Recombinant Human Putative Wilms tumor upstream neighbor 1 gene protein (WIT1) spans the amino acid sequence from region 1-92. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative Wilms tumor upstream neighbor 1 gene protein; WIT-1; Wilms tumor-associated antisense RNA; WT1-AS WIT1

UniProt

Q06250

Expression Region

1-92

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MQRRGQPLENHVALIHWQSAGIPASKVHNYCNMKKSRLGRSRAVRISQPLLSPRRCPLHLTERGAGLLQPQPQGPVRTPGPPSGSHPAAADN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Myocyte Enhancer Factor 2A (MEF2A) ELISA Kit
abx381404 96 Tests

Human Myocyte Enhancer Factor 2A (MEF2A) ELISA Kit

Sign In for Pricing
View Details
BMP10 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-9447R-BF405 100 µL

BMP10 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
CTNA1, NT (Catenin alpha-1, Cadherin-associated Protein, Alpha E-catenin, Renal Carcinoma Antigen NY-REN-13, CTNNA1) (MaxLight 750)
MBS6467216-01 0.1 mL

CTNA1, NT (Catenin alpha-1, Cadherin-associated Protein, Alpha E-catenin, Renal Carcinoma Antigen NY-REN-13, CTNNA1) (MaxLight 750)

Sign In for Pricing
View Details
CTNA1, NT (Catenin alpha-1, Cadherin-associated Protein, Alpha E-catenin, Renal Carcinoma Antigen NY-REN-13, CTNNA1) (MaxLight 750)
MBS6467216-02 5x 0.1 mL

CTNA1, NT (Catenin alpha-1, Cadherin-associated Protein, Alpha E-catenin, Renal Carcinoma Antigen NY-REN-13, CTNNA1) (MaxLight 750)

Sign In for Pricing
View Details
CTCF Peptide
orb2018378 100 µg

CTCF Peptide

Sign In for Pricing
View Details
TOMM22 Recombinant Antibody, APC Conjugated
bsm-62109R-APC-TR 20 µL

TOMM22 Recombinant Antibody, APC Conjugated

Sign In for Pricing
View Details