Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Zinc finger protein 616 (ZN616)

This Recombinant Human Zinc finger protein 616 (ZN616) spans the amino acid sequence from region 1-781. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Zinc finger protein 616 ZNF616

UniProt

Q08AN1

Expression Region

1-781

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MATQGHLTFKDVAIEFSQEEWKCLEPVQKALYKDVMLENYRNLVFLGISPKCVIKELPPTENSNTGERFQTVALERHQSYDIENLYFREIQKHLHDLEFQWKDGETNDKEVPVPHENNLTGKRDQHSQGDVENNHIENQLTSNFESRLAELQKVQTEGRLYECNETEKTGNNGCLVSPHIREKTYVCNECGKAFKASSSLINHQRIHTTEKPYKCNECGKAFHRASLLTVHKVVHTRGKSYQCDVCGKIFRKNSYFVRHQRSHTGQKPYICNECGKSFSKSSHLAVHQRIHTGEKPYKCNLCGKSFSQRVHLRLHQTVHTGERPFKCNECGKTFKRSSNLTVHQVIHAGKKPYKCDVCGKAFRHRSNLVCHRRIHSGEKQYKCNECGKVFSKRSSLAVHRRIHTVEKPCKCNECGKVFSKRSSLAVHQRIHTGQKTYKCNKCGKVYSKHSHLAVHWRIHTGEKAYKCNECGKVFSIHSRLAAHQRIHTGEKPYKCNECGKVFSQHSRLAVHRRIHTGEKPYKCKECGKVFSDRSAFARHRRIHTGEKPYKCKECGKVFSQCSRLTVHRRIHSGEKPYKCNECGKVYSQYSHLVGHRRVHTGEKPYKCHECGKAFNQGSTLNRHQRIHTGEKPYKCNQCGNSFSQRVHLRLHQTVHTGDRPYKCNECGKTFKRSSNLTAHQIIHAGKKPYKCDECGKVFRHSSHLVSHQRIHTGEKRYKCIECGKAFGRLFSLSKHQRIHSGKKPYKCNECGKSFICRSGLTKHRIRHTGESLTTKLNVTRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-MICALL1 Antibody Picoband® Fluoro594 Conjugated
A09767-1-Fluoro594 100 µg/Vial

Anti-MICALL1 Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
Apolipoprotein A-I/ApoAI Protein (hFc-tag)
M60-002-L100 100 µg

Apolipoprotein A-I/ApoAI Protein (hFc-tag)

Sign In for Pricing
View Details
Magnesium Chloride Hexahydrate for cell culture, 99.5%, Endotoxin (BET) 0.05EU/mg
13546 500 g

Magnesium Chloride Hexahydrate for cell culture, 99.5%, Endotoxin (BET) 0.05EU/mg

Sign In for Pricing
View Details
MYBL1 CRISPR Knock Out 293T Cell Line (Human)
31199141 1x 10^6 Cells / 1.0 mL

MYBL1 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Bcl2l10 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6254006 1.0 µg DNA

Bcl2l10 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Anti-Phospho-POLR2A (Thr4) Polyclonal Antibody 2
TMAC-03634-01 50 μL

Anti-Phospho-POLR2A (Thr4) Polyclonal Antibody 2

Sign In for Pricing
View Details