Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human XK-related protein 6 (XKR6), partial

This Recombinant Human XK-related protein 6 (XKR6), partial spans the amino acid sequence from region 494-641. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

XK-related protein 6 XKR6 C8orf21 C8orf5 C8orf7 XRG6

UniProt

Q5GH73

Expression Region

494-641

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YYGVLHPTGPRAKILASSCCAELLWGIPLPPDVEPMAPEIPGYRGTQVTPTRAVTEQQEDLTADTCLPVFQVRPMGPPTPLGRPYLPEGPLIKIDMPRKRYPAWDAHFVDRRLRRTINILQYVTPTAVGIRYRDGPLLYELLQYESSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Active Recombinant Human PDCD1 Protein, hFc-tagged, Alexa Fluor 488 conjugated
PDCD1-032HAF488 20 μg- 50 μg- 100 μg

Active Recombinant Human PDCD1 Protein, hFc-tagged, Alexa Fluor 488 conjugated

Sign In for Pricing
View Details
Prelp 3'UTR Luciferase Stable Cell Line
TU216745 1.0 mL

Prelp 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Anti-PD-1 (peresolimab biosimilar) mAb
MBS1881540-01 0.05 mg

Anti-PD-1 (peresolimab biosimilar) mAb

Sign In for Pricing
View Details
Anti-PD-1 (peresolimab biosimilar) mAb
MBS1881540-02 0.1 mg

Anti-PD-1 (peresolimab biosimilar) mAb

Sign In for Pricing
View Details
Anti-PD-1 (peresolimab biosimilar) mAb
MBS1881540-03 5x 0.1 mg

Anti-PD-1 (peresolimab biosimilar) mAb

Sign In for Pricing
View Details
OOCA01498-25T - Human RYR3 Primer Pair 1
OOCA01498-25T 25 Tests

OOCA01498-25T - Human RYR3 Primer Pair 1

Sign In for Pricing
View Details