Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 8G2 (O8G2P), partial

This Recombinant Human Olfactory receptor 8G2 (O8G2P), partial spans the amino acid sequence from region 1-41. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Olfactory receptor 8G2; Olfactory receptor 8G4; Olfactory receptor OR11-292; Olfactory receptor TPCR120; OR8G2P OR8G2 OR8G4

UniProt

Q6IF36

Expression Region

1-41

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MVFLSSVETDQRKMSAGNHSSVTEFILAGLSEQPELQLRLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTMR14 Human qPCR Template Standard (NM_022485)
HK204945 1 Kit

MTMR14 Human qPCR Template Standard (NM_022485)

Sign In for Pricing
View Details
Ankub1 Mouse shRNA Plasmid (Locus ID 242037)
TL512912 1 Kit

Ankub1 Mouse shRNA Plasmid (Locus ID 242037)

Sign In for Pricing
View Details
Tal1 Mouse shRNA Lentiviral Particle (Locus ID 21349)
TL513982V 500 µL Each

Tal1 Mouse shRNA Lentiviral Particle (Locus ID 21349)

Sign In for Pricing
View Details
Lentiviral mouse Dazap1 shRNA (UAS) - Lentiviral mouse Dazap1 shRNA (UAS) (100)
GTR15187854 1 Vial

Lentiviral mouse Dazap1 shRNA (UAS) - Lentiviral mouse Dazap1 shRNA (UAS) (100)

Sign In for Pricing
View Details
CHO Monoclonal Frizzled-7 Antibody (U.Toronto patent anti-FZD7) - Humanized - (Dry Ice)
NBP3-28845-1mg 1 mg

CHO Monoclonal Frizzled-7 Antibody (U.Toronto patent anti-FZD7) - Humanized - (Dry Ice)

Sign In for Pricing
View Details
KLF10 Polyclonal Antibody
MBS9133228-01 0.02 mL

KLF10 Polyclonal Antibody

Sign In for Pricing
View Details