Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative pro-MCH-like protein 2 (MCHL2)

This Recombinant Human Putative pro-MCH-like protein 2 (MCHL2) spans the amino acid sequence from region 1-86. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative pro-MCH-like protein 2; Pro-melanin-concentrating hormone-like protein 2; PMCHL2

UniProt

Q9BQD1

Expression Region

1-86

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MLSQKTKKKHNFLNHGLSLNLVIKPYLALEGSVAFPAENGVQDTESTLEKRETGDEENSAKFPIGRRDFDTLRCMLGRVYQRCWQV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Cystatin C ELISA Kit (Updated)
80738 96 Well

Mouse Cystatin C ELISA Kit (Updated)

Sign In for Pricing
View Details
Ammonium-15N Bromide
TRC-A633847-100MG 100 mg

Ammonium-15N Bromide

Sign In for Pricing
View Details
2,3-Diaminobenzonitrile hydrochloride
GAD32868 2.5 g

2,3-Diaminobenzonitrile hydrochloride

Sign In for Pricing
View Details
CD26 Rabbit Polyclonal Antibody (APC-Cy7)
orb1603251 100 µL

CD26 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
Rxfp1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3351806 1.0 µg DNA

Rxfp1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Human MYC Protein Lysate
MBS8415672-01 0.02 mg

Human MYC Protein Lysate

Sign In for Pricing
View Details