Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Rhomboid domain-containing protein 3 (RHBD3), partial

This Recombinant Human Rhomboid domain-containing protein 3 (RHBD3), partial spans the amino acid sequence from region 184-386. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Rhomboid domain-containing protein 3 RHBDD3 C22orf3

UniProt

Q9Y3P4

Expression Region

184-386

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RWLEPSERRLQVLQEGVLCRTLAGCWPLRLLATPGSLAELPVTHPAGVRPPIPGPPYVASPDLWSHWEDSALPPPSLRPVQPTWEGSSEAGLDWAGASFSPGTPMWAALDEQMLQEGIQASLLDGPAQEPQSAPWLSKSSVSSLRLQQLERMGFPTEQAVVALAATGRVEGAVSLLVGGQVGTETLVTHGKGGPAHSEGPGPP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SSR128129E
TRC-S684470-5MG 5 mg

SSR128129E

Sign In for Pricing
View Details
C6orf140 (GLYATL3) (NM_001010904) Human Over-expression Lysate
LC425285 20 µg

C6orf140 (GLYATL3) (NM_001010904) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Lymph node
CS631695 5x 5 µm

Frozen Tissue Sections, Lymph node

Sign In for Pricing
View Details
Human CREB3L1 activation kit by CRISPRa
GA114078 1 Kit

Human CREB3L1 activation kit by CRISPRa

Sign In for Pricing
View Details
Crebbp Mouse Gene Knockout Kit (CRISPR)
KN303812 1 Kit

Crebbp Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human KCT2 (C5orf15) activation kit by CRISPRa
GA111297 1 Kit

Human KCT2 (C5orf15) activation kit by CRISPRa

Sign In for Pricing
View Details