Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Insulin-like peptide INSL6 (INSL6), partial

This Recombinant Human Insulin-like peptide INSL6 (INSL6), partial spans the amino acid sequence from region 21-54. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Insulin-like peptide INSL6; Insulin-like peptide 6; Relaxin/insulin-like factor 1; [Cleaved into: Insulin-like peptide INSL6 B chain; Insulin-like peptide INSL6 A chain] INSL6 RIF1

UniProt

Q9Y581

Expression Region

21-54

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RELSDISSARKLCGRYLVKEIEKLCGHANWSQFR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDE4B Peptide
42-925P 0.1 mg

PDE4B Peptide

Sign In for Pricing
View Details
CTPS (Ctp Synthase, CTP Synthase 1, CTP Synthetase 1, UTP--ammonia Ligase 1) (MaxLight 650)
MBS6400303-01 0.1 mL

CTPS (Ctp Synthase, CTP Synthase 1, CTP Synthetase 1, UTP--ammonia Ligase 1) (MaxLight 650)

Sign In for Pricing
View Details
CTPS (Ctp Synthase, CTP Synthase 1, CTP Synthetase 1, UTP--ammonia Ligase 1) (MaxLight 650)
MBS6400303-02 5x 0.1 mL

CTPS (Ctp Synthase, CTP Synthase 1, CTP Synthetase 1, UTP--ammonia Ligase 1) (MaxLight 650)

Sign In for Pricing
View Details
ECM1 Rabbit Polyclonal Antibody (APC)
orb3109437 100 µg

ECM1 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Recombinant Candida Albicans RIB3 Protein (aa 1-204)
VAng-Lsx05865-1mgEcoli 1 mg (E. coli)

Recombinant Candida Albicans RIB3 Protein (aa 1-204)

Sign In for Pricing
View Details
USP31 CRISPRa sgRNA lentivector (set of three targets)(Rat)
49310126 3x 1.0µg DNA

USP31 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details