Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 265 (TM265), partial

This Recombinant Human Transmembrane protein 265 (TM265), partial spans the amino acid sequence from region 1-33. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transmembrane protein 265 TMEM265

UniProt

A0A087WTH1

Expression Region

1-33

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MEDEEKAVEILGNTEAAHPPSPIRCCWLRLRCL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLSCR2 Antibody - C-terminal region
ARP66433_P050-25UL 25 µL

PLSCR2 Antibody - C-terminal region

Sign In for Pricing
View Details
ADCY 1 (ADCY1, Adenylate cyclase type 1, ATP pyrophosphate-lyase 1, Adenylate cyclase type I, Adenylyl cyclase 1, Ca (2+) /calmodulin-activated adenylyl cyclase)
304863-01 50 µL

ADCY 1 (ADCY1, Adenylate cyclase type 1, ATP pyrophosphate-lyase 1, Adenylate cyclase type I, Adenylyl cyclase 1, Ca (2+) /calmodulin-activated adenylyl cyclase)

Sign In for Pricing
View Details
ADCY 1 (ADCY1, Adenylate cyclase type 1, ATP pyrophosphate-lyase 1, Adenylate cyclase type I, Adenylyl cyclase 1, Ca (2+) /calmodulin-activated adenylyl cyclase)
304863-02 100 µL

ADCY 1 (ADCY1, Adenylate cyclase type 1, ATP pyrophosphate-lyase 1, Adenylate cyclase type I, Adenylyl cyclase 1, Ca (2+) /calmodulin-activated adenylyl cyclase)

Sign In for Pricing
View Details
Rutaecarpine
C16793-100mg 100 mg

Rutaecarpine

Sign In for Pricing
View Details
Active Recombinant Human WDR61 protein, His-tagged
WDR61-371H 100 µg

Active Recombinant Human WDR61 protein, His-tagged

Sign In for Pricing
View Details
1-Boc-2-Ethynylpyrrolidine
RMA14137-01 2 g

1-Boc-2-Ethynylpyrrolidine

Sign In for Pricing
View Details