Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human PIK3R3 upstream open reading frame protein (P3URF)

This Recombinant Human PIK3R3 upstream open reading frame protein (P3URF) spans the amino acid sequence from region 1-95. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PIK3R3 upstream open reading frame protein P3R3URF

UniProt

A0A087WWA1

Expression Region

1-95

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGPSRLVRGPRPQGMRSPYRRPGMGWPRPRFPRMFKCSRRRYQQGLRGRTASSAAINPATRAMGINNTHTDTTIVWIFPPQVLRHLRQPGIFLIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MED19 Rabbit Polyclonal Antibody
TA330946 100 µL

MED19 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SNORD115-37 CRISPR Knock Out 293T Cell Line (Human)
44761141 1x 10^6 Cells / 1.0 mL

SNORD115-37 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Human MIR1253 qPCR Primer Pair
QH83413S 200 Tests

Human MIR1253 qPCR Primer Pair

Sign In for Pricing
View Details
Human Nck-Associated Protein 5 (NCKAP5) ELISA Kit
abx534668 96 Tests

Human Nck-Associated Protein 5 (NCKAP5) ELISA Kit

Sign In for Pricing
View Details
Human SSA IgG Antibody ELISA Kit
MBS3804820-01 48 Well

Human SSA IgG Antibody ELISA Kit

Sign In for Pricing
View Details
Human SSA IgG Antibody ELISA Kit
MBS3804820-02 96 Well

Human SSA IgG Antibody ELISA Kit

Sign In for Pricing
View Details