Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Beta-defensin 131B (D131B)

This Recombinant Human Beta-defensin 131B (D131B) spans the amino acid sequence from region 23-70. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Beta-defensin 131B; Defensin, beta 131; DEFB131B

UniProt

A0A096LNP1

Expression Region

23-70

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

FTSNDECPSEYYHCRLKCNADEHAIRYCADFSICCKLKIIQIDGQKKW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELL3 Rabbit polyclonal Antibody
ER61160 100 µL

ELL3 Rabbit polyclonal Antibody

Sign In for Pricing
View Details
2,3-Naphthalenedicarboxylic Acid
TRC-N356010-250MG 250 mg

2,3-Naphthalenedicarboxylic Acid

Sign In for Pricing
View Details
ETV2 Rabbit Polyclonal Antibody
TA372511 100 µL

ETV2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD1c Recombinant Rabbit Monoclonal Antibody [JE55-00]
HA722562 100 µL

CD1c Recombinant Rabbit Monoclonal Antibody [JE55-00]

Sign In for Pricing
View Details
Propionyl Coenzyme A Lithium Salt (>85%)
TRC-P839043-5MG 5 mg

Propionyl Coenzyme A Lithium Salt (>85%)

Sign In for Pricing
View Details
4-Aminobutyric-2,2-d2 Acid
TRC-A602921-25MG 25 mg

4-Aminobutyric-2,2-d2 Acid

Sign In for Pricing
View Details