Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Beta-defensin 131B (D131B)

This Recombinant Human Beta-defensin 131B (D131B) spans the amino acid sequence from region 23-70. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Beta-defensin 131B; Defensin, beta 131; DEFB131B

UniProt

A0A096LNP1

Expression Region

23-70

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

FTSNDECPSEYYHCRLKCNADEHAIRYCADFSICCKLKIIQIDGQKKW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Gabra1 activation kit by CRISPRa
GA201513 1 Kit

Mouse Gabra1 activation kit by CRISPRa

Sign In for Pricing
View Details
DHCR7 Human Gene Knockout Kit (CRISPR)
KN400480 1 Kit

DHCR7 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Creatine kinase B type (CKB) Rabbit Polyclonal Antibody
AP13618PU-N 400 µL

Creatine kinase B type (CKB) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Testis
CR562835 5 µg

Tissue Total RNA, Testis

Sign In for Pricing
View Details
CD19 Recombinant Rabbit monoclonal Antibody
IRS018 100 µL

CD19 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/2831R), CF568 conjugate, 0.1mg/mL
BNC682831-100 1x 100 µL

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/2831R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details