Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Beta-defensin 131B (D131B)

This Recombinant Human Beta-defensin 131B (D131B) spans the amino acid sequence from region 23-70. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Beta-defensin 131B; Defensin, beta 131; DEFB131B

UniProt

A0A096LNP1

Expression Region

23-70

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

FTSNDECPSEYYHCRLKCNADEHAIRYCADFSICCKLKIIQIDGQKKW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Acetamidophthalic Acid
TRC-A161140-5MG 5 mg

3-Acetamidophthalic Acid

Sign In for Pricing
View Details
BDH1 Mouse Monoclonal Antibody [Clone ID: 1A5]
AM06382SU-N 100 µL

BDH1 Mouse Monoclonal Antibody [Clone ID: 1A5]

Sign In for Pricing
View Details
MCM7 (Proliferation Marker) (MCM7/1469), CF740 conjugate, 0.1mg/mL
BNC741469-100 1x 100 µL

MCM7 (Proliferation Marker) (MCM7/1469), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CY5 Triethylamine Salt
TRC-C951320-5MG 5 mg

CY5 Triethylamine Salt

Sign In for Pricing
View Details
FANCF Rabbit Polyclonal Antibody
AP09249PU-N 100 µg

FANCF Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Aquaporin 5 (AQP5) (C-term) Rabbit Polyclonal Antibody
AP23312PU-N 100 µg

Aquaporin 5 (AQP5) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details