Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda joining 1 (LJ01)

This Recombinant Human Immunoglobulin lambda joining 1 (LJ01) spans the amino acid sequence from region 1-42. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda joining 1 IGLJ1

UniProt

A0A0A0MT76

Expression Region

1-42

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

PSRLLLQPSPQRADPRCWPRGFWSEPQSLCYVFGTGTKVTVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Protective film
K-MQF-100 100 PCS

Protective film

Sign In for Pricing
View Details
General Phosphatidylinositol 4,5-bisphosphate, PIP2 ELISA KIT
EA0051Ge-01 96 Well

General Phosphatidylinositol 4,5-bisphosphate, PIP2 ELISA KIT

Sign In for Pricing
View Details
Mouse Monoclonal SLFNL1 Antibody (OTI1G2) [Alexa Fluor 750]
NBP2-74223AF750 0.1 mL

Mouse Monoclonal SLFNL1 Antibody (OTI1G2) [Alexa Fluor 750]

Sign In for Pricing
View Details
E3 ubiquitin-protein ligase DTX3L (DTX3L) Human ELISA Kit
D0581 96 Tests

E3 ubiquitin-protein ligase DTX3L (DTX3L) Human ELISA Kit

Sign In for Pricing
View Details
KIF16B (C20orf23, Kinesin-like Protein KIF16B, Sorting Nexin-23, KIAA1590, SNX23) (MaxLight 750) discontinued
128812-ML750 100 µL

KIF16B (C20orf23, Kinesin-like Protein KIF16B, Sorting Nexin-23, KIAA1590, SNX23) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Mmu-miR-3552 agomir
HY-R03087A-01 5 nmol

Mmu-miR-3552 agomir

Sign In for Pricing
View Details