Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein MMP24OS (MMPOS)

This Recombinant Human Protein MMP24OS (MMPOS) spans the amino acid sequence from region 1-71. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein MMP24OS; MMP24 opposite strand; MMP24OS MMP24-AS1

UniProt

A0A0U1RRL7

Expression Region

1-71

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGAQLSGGRGAPEPAQTQPQPQPQPAAPEGPEQPRHPPQPQPQPQPQPQPEPSPWGPLDDVRFLIACTSWY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RANTES Antibody Pair Set
E-KAB-0206 50 µL & 100 µg

Human RANTES Antibody Pair Set

Sign In for Pricing
View Details
Rbm15 Mouse Monoclonal Antibody [A10H4]
HA601347 100 µL

Rbm15 Mouse Monoclonal Antibody [A10H4]

Sign In for Pricing
View Details
FOXO1 pSer256 Rabbit Polyclonal Antibody
AP20803PU-N 100 µg

FOXO1 pSer256 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GATA5 Human Gene Knockout Kit (CRISPR)
KN418399 1 Kit

GATA5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Etaa1 activation kit by CRISPRa
GA207694 1 Kit

Mouse Etaa1 activation kit by CRISPRa

Sign In for Pricing
View Details
Triethoxy(octyl)silane
TRC-T773455-50G 50 g

Triethoxy(octyl)silane

Sign In for Pricing
View Details