Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Casein kinase II subunit alpha'-interacting protein (CS2IP)

This Recombinant Human Casein kinase II subunit alpha'-interacting protein (CS2IP) spans the amino acid sequence from region 1-734. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Casein kinase II subunit alpha'-interacting protein; Casein kinase 2 alpha prime interacting protein; CSNK2A2IP CSNKA2IP

UniProt

A0A1B0GTH6

Expression Region

1-734

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MVPLAYYGQHFVPLDYFYQLSSANTLTHQHTGEKLNQFNNQPMAKVQSHSNHFAVPPLGSNKKVQRCSVLPSPKSQDKISQSFCDRFLNSPLFHAKHQNTPSIGLHWRSSLWPAQRALNSHLLHSKAQTTSSSDLNMTSSLELNQAALSLQLPFCKPQTTSSSLDVCWRSLSLKSHQRVSSSSLFRLQNQEIPSINIIWTSSSLGPKRKALSSTLLQSKPQKTSSLDYLWTSSLQRNQRSLSSPSLNTKLQTSDLFWTSPSFKPNQIALTSPLLDSRLQKTPILNSNPTIGGLPVSHSKARQSASSYFVHPSENLPLFQLNSQSMFMLDCNFQTTNSPVCHSKFQNTTSPNGKHRVTHLPSPHPKTNISGQLLSSSKHCTRNTAASTLGFRLQSKSSFQFSPKTESNKEIPWTLKYSQPCIVKGGTVPDDVVNKIVNSISNTRIQRDLCRQILFRRMRGRPNPHPGPRLSSNYVVCLACASCLKSPCNHLRGKKNPHCATLSVIPTPEANSEGKIEVKLVLILSLPETFSSCLPFPMKENQPNEVPEDNLEGVEKIQQFFPTSERDIQGLNMKQIWWAVAPENKVIGQQPQAIDWLFYVKKNNSQPQSLLPSTSSSTSSSSTTSSSSSVASASSDSSSSSSSSSSFSISSSSSPSKEFMTLTLSRPVFRKVLSYHRLPAGVSWLEFIYSKDYQLHPRKPNRSQSSSLKTKPVRNNNTVKWRKGANTLFKFFRTK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BIRC5 (NM_001168) Human Recombinant Protein
TP305935 20 µg

BIRC5 (NM_001168) Human Recombinant Protein

Sign In for Pricing
View Details
VPS53 Human Gene Knockout Kit (CRISPR)
KN402970 1 Kit

VPS53 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Protein Lysate, Lymphoid tissue
CP565838 150 µg

Tissue Protein Lysate, Lymphoid tissue

Sign In for Pricing
View Details
XFD610 acid
70060-AAT 10 mg

XFD610 acid

Sign In for Pricing
View Details
TSPAN6 Human Gene Knockout Kit (CRISPR)
KN402014 1 Kit

TSPAN6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Porcine TFPI Antibody Pair Set
E-KAB-0674 50 µL & 100 µg

Porcine TFPI Antibody Pair Set

Sign In for Pricing
View Details