Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Casein kinase II subunit alpha'-interacting protein (CS2IP)

This Recombinant Human Casein kinase II subunit alpha'-interacting protein (CS2IP) spans the amino acid sequence from region 1-734. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Casein kinase II subunit alpha'-interacting protein; Casein kinase 2 alpha prime interacting protein; CSNK2A2IP CSNKA2IP

UniProt

A0A1B0GTH6

Expression Region

1-734

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MVPLAYYGQHFVPLDYFYQLSSANTLTHQHTGEKLNQFNNQPMAKVQSHSNHFAVPPLGSNKKVQRCSVLPSPKSQDKISQSFCDRFLNSPLFHAKHQNTPSIGLHWRSSLWPAQRALNSHLLHSKAQTTSSSDLNMTSSLELNQAALSLQLPFCKPQTTSSSLDVCWRSLSLKSHQRVSSSSLFRLQNQEIPSINIIWTSSSLGPKRKALSSTLLQSKPQKTSSLDYLWTSSLQRNQRSLSSPSLNTKLQTSDLFWTSPSFKPNQIALTSPLLDSRLQKTPILNSNPTIGGLPVSHSKARQSASSYFVHPSENLPLFQLNSQSMFMLDCNFQTTNSPVCHSKFQNTTSPNGKHRVTHLPSPHPKTNISGQLLSSSKHCTRNTAASTLGFRLQSKSSFQFSPKTESNKEIPWTLKYSQPCIVKGGTVPDDVVNKIVNSISNTRIQRDLCRQILFRRMRGRPNPHPGPRLSSNYVVCLACASCLKSPCNHLRGKKNPHCATLSVIPTPEANSEGKIEVKLVLILSLPETFSSCLPFPMKENQPNEVPEDNLEGVEKIQQFFPTSERDIQGLNMKQIWWAVAPENKVIGQQPQAIDWLFYVKKNNSQPQSLLPSTSSSTSSSSTTSSSSSVASASSDSSSSSSSSSSFSISSSSSPSKEFMTLTLSRPVFRKVLSYHRLPAGVSWLEFIYSKDYQLHPRKPNRSQSSSLKTKPVRNNNTVKWRKGANTLFKFFRTK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal IGSF4D/SynCAM2/CADM2 Antibody [DyLight 594]
NBP3-06626DL594 0.1 mL

Rabbit Polyclonal IGSF4D/SynCAM2/CADM2 Antibody [DyLight 594]

Sign In for Pricing
View Details
Epithelial-Cadherin (E-Cad) Mouse ELISA Kit
D0492 96 Tests

Epithelial-Cadherin (E-Cad) Mouse ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal DC-SIGNR/CD299/CLEC4M Antibody
NBP2-48770 0.1 mL

Rabbit Polyclonal DC-SIGNR/CD299/CLEC4M Antibody

Sign In for Pricing
View Details
Insulin human rec., 10 mg/ mL Solution
P07-04300 10 mL

Insulin human rec., 10 mg/ mL Solution

Sign In for Pricing
View Details
Anti-Oligodendrocyte myelin glycoprotein/OMG Antibody Picoband® Fluoro550 Conjugated
PB9730-Fluoro550 100 µg/Vial

Anti-Oligodendrocyte myelin glycoprotein/OMG Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
Mouse Monoclonal CD45 Antibody (SPM496) [DyLight 405]
NBP3-11496V 0.1 mL

Mouse Monoclonal CD45 Antibody (SPM496) [DyLight 405]

Sign In for Pricing
View Details