Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Zinc finger protein 475 (ZN475)

This Recombinant Human Zinc finger protein 475 (ZN475) spans the amino acid sequence from region 1-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Zinc finger protein 475 ZNF475

UniProt

A0A1B0GTH9

Expression Region

1-108

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MIRRPPAVVCYICGREYGTKSISIHEPQCLKKWHNENNLLPKELRRPVPKKPEVRTITAKGFYDLDALNEAAWTSAHSQLVPCNVCGRTFLPDRLIVHQRSCKPKAAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal ERCC1 Antibody (ERCC1 3H11) [PerCP]
NB100-117PCP 0.1 mL

Mouse Monoclonal ERCC1 Antibody (ERCC1 3H11) [PerCP]

Sign In for Pricing
View Details
Lentiviral human CCDC42 shRNA (UAS) - Lentiviral human CCDC42 shRNA (UAS) (100)
GTR15314889 1 Vial

Lentiviral human CCDC42 shRNA (UAS) - Lentiviral human CCDC42 shRNA (UAS) (100)

Sign In for Pricing
View Details
BARHL1 (NM_020064) Human Mass Spec Standard
PH320559 10 µg

BARHL1 (NM_020064) Human Mass Spec Standard

Sign In for Pricing
View Details
Aurora Kinase Inhibitor 3 50mg
A19448-50 50 mg

Aurora Kinase Inhibitor 3 50mg

Sign In for Pricing
View Details
LMNTD2 Rabbit Polyclonal Antibody (Fluoro594)
orb3092190 100 µg

LMNTD2 Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
Mouse Nkx6-1 qPCR Primer Pair
QM04166S 200 Tests

Mouse Nkx6-1 qPCR Primer Pair

Sign In for Pricing
View Details