Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 272 (TM272), partial

This Recombinant Human Transmembrane protein 272 (TM272), partial spans the amino acid sequence from region 73-106. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transmembrane protein 272 TMEM272

UniProt

A0A1B0GTI8

Expression Region

73-106

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YDSTRMRRLLSKAVVIDDDDDDEYPWRQNAHRYY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MART-1 / Melan-A (A103), CF488A conjugate, 0.1mg/mL
BNC880668-500 1x 500 µL

MART-1 / Melan-A (A103), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Mouse APCS/SAP Protein (His Tag)
PKSM040858 100 µg

Recombinant Mouse APCS/SAP Protein (His Tag)

Sign In for Pricing
View Details
DNase II (DNASE2) (NM_001375) Human Over-expression Lysate
LY419982 100 µg

DNase II (DNASE2) (NM_001375) Human Over-expression Lysate

Sign In for Pricing
View Details
Cathepsin L Recombinant Rabbit monoclonal Antibody
HA750917 100 µL

Cathepsin L Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
TPM1 (NM_001018006) Human Recombinant Protein
TP319606L 1 mg

TPM1 (NM_001018006) Human Recombinant Protein

Sign In for Pricing
View Details
Frozen Tissue Sections, Soft tissue
CS629805 5x 5 µm

Frozen Tissue Sections, Soft tissue

Sign In for Pricing
View Details