Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Epididymal protein 13 (EDD13)

This Recombinant Human Epididymal protein 13 (EDD13) spans the amino acid sequence from region 24-161. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Epididymal protein 13 EDDM13

UniProt

A0A1B0GTR0

Expression Region

24-161

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

CTPREVATKEKINLLKGIIGLMSRLSPDGLRHNITSLKMPPLVSPQDRTEEEIKKILGLLSLQVLHEETSGCKEEVKPFSGTTPSRKPLPKRKNTWNFLKCAYMVMTYLFVSYNKGDWCYCHYCNLELDIRDDPCCSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TPM1 (NM_001018006) Human Over-expression Lysate
LY422689 100 µg

TPM1 (NM_001018006) Human Over-expression Lysate

Sign In for Pricing
View Details
Camel IgG (H+L), AlpHcAbs®
HA710011 200 µg

Camel IgG (H+L), AlpHcAbs®

Sign In for Pricing
View Details
Frozen Tissue Sections, Cervix
CS503888 5x 5 µm

Frozen Tissue Sections, Cervix

Sign In for Pricing
View Details
RWDD1 (NM_001007464) Human Over-expression Lysate
LY423486 100 µg

RWDD1 (NM_001007464) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant ILF3 Monoclonal Antibody
E-AB-81475-01 50 µL

Recombinant ILF3 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant ILF3 Monoclonal Antibody
E-AB-81475-02 100 µL

Recombinant ILF3 Monoclonal Antibody

Sign In for Pricing
View Details