Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Versican core protein (VCAN) , partial

Product Specifications

CAS Number

9000-83-3

Gene Name

VCAN

UniProt

P13611

Expression Region

3089-3354aa

Organism

Homo sapiens

Target Sequence

GPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMN

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Field of Research

Signal Transduction

Assay Type

Developed Protein

Relevance

May play a role in intercellular signaling and in connecting cells with the extracellular matrix. May take part in the regulation of cell motility, growth and differentiation. Binds hyaluronic acid.

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Length

Partial

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May play a role in intercellular signaling and in connecting cells with the extracellular matrix. May take part in the regulation of cell motility, growth and differentiation. Binds hyaluronic acid.

Molecular Weight

34.6 kDa

References & Citations

"An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome." Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H. J. Proteomics 96:253-262 (2014)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

THT-156-492-3 Pre-sized Labels for Printers
805915 3000 Roll (3000 Label (s) x 1 Roll)

THT-156-492-3 Pre-sized Labels for Printers

Sign In for Pricing
View Details
Mouse Monoclonal ARHGEF4 Antibody (ARHGEF-08) [Alexa Fluor 532]
NBP2-62217AF532 0.1 mL

Mouse Monoclonal ARHGEF4 Antibody (ARHGEF-08) [Alexa Fluor 532]

Sign In for Pricing
View Details
SSTR5 antibody
FNab08255 100 µg

SSTR5 antibody

Sign In for Pricing
View Details
RDH10 CRISPR Activation Plasmid (h2)
sc-414765-ACT-2 20 µg

RDH10 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
KLHL7 Recombinant Protein Antigen
NBP1-81349PEP 0.1 mL

KLHL7 Recombinant Protein Antigen

Sign In for Pricing
View Details
GLS2 (NM_013267) Human Over-expression Lysate
LH08869V 100 µg

GLS2 (NM_013267) Human Over-expression Lysate

Sign In for Pricing
View Details