Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Coiled-coil domain-containing protein 196 (CC196)

This Recombinant Human Coiled-coil domain-containing protein 196 (CC196) spans the amino acid sequence from region 1-297. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 196; Long intergenic non-protein coding RNA 238; CCDC196 C14orf53 LINC00238 NCRNA00238

UniProt

A0A1B0GTZ2

Expression Region

1-297

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MTSGANSSGSYLPSEIRSSKIDDNYLKELNEDLKLRKQELLEMLKPLEDKNNLLFQKLMSNLEEKQRSLQIMRQIMAGKGCEESSVMELLKEAEEMKQNLERKNKMLRKEMEMLWNKTFEAEELSDQQKAPQTKNKADLQDGKAPKSPSSPRKTESELEKSFAEKVKEIRKEKQQRKMEWVKYQEQNNILQNDFHGKVIELRIEALKNYQKANDLKLSLYLQQNFEPMQAFLNLPGSQGTMGITTMDRVTTGRNEHHVRILGTKIYTEQQGTKGSQLDNTGGRLFFLRSLPDEALKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pimeloyl chloride 98%
P19460 5 g

Pimeloyl chloride 98%

Sign In for Pricing
View Details
Carbonic Anhydrase 1 Rabbit mAb
MBS4761422-01 0.1 mL

Carbonic Anhydrase 1 Rabbit mAb

Sign In for Pricing
View Details
Carbonic Anhydrase 1 Rabbit mAb
MBS4761422-02 5x 0.1 mL

Carbonic Anhydrase 1 Rabbit mAb

Sign In for Pricing
View Details
CLEC4C Recombinant Monoclonal Antibody
MBS9019402-01 0.05 mL

CLEC4C Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
CLEC4C Recombinant Monoclonal Antibody
MBS9019402-02 0.1 mL

CLEC4C Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
CLEC4C Recombinant Monoclonal Antibody
MBS9019402-03 5x 0.1 mL

CLEC4C Recombinant Monoclonal Antibody

Sign In for Pricing
View Details