Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 48 (TEX48)

This Recombinant Human Testis-expressed protein 48 (TEX48) spans the amino acid sequence from region 1-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 48 TEX48

UniProt

A0A1B0GUV7

Expression Region

1-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAAHQNLILKIFCLCCRDCQEPYAINDSKVPSQTQEHKPSTQNLLLQKDELDRQNPKRINAVSHLPSRTPLIQTKKSTSSSSSEFEDLNAYASQRNFYKRNLNRYCQEHWPFQPCLTGRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-(2,3-Dichlorophenyl)piperazine Hydrochloride
TRC-D435750-50MG 50 mg

N-(2,3-Dichlorophenyl)piperazine Hydrochloride

Sign In for Pricing
View Details
CORD2 (CRX) Human Gene Knockout Kit (CRISPR)
KN402160 1 Kit

CORD2 (CRX) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
P40 (deltaNp63) (Squamous, Basal & Myoepithelial Cell Marker), CF488A conjugate, 0.1mg/mL
BNC882314-500 1x 500 µL

P40 (deltaNp63) (Squamous, Basal & Myoepithelial Cell Marker), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
XRCC2 Antibody
8C0396-AAT 50 µg

XRCC2 Antibody

Sign In for Pricing
View Details
Cathepsin H Antibody
OC-636-01 50 μL

Cathepsin H Antibody

Sign In for Pricing
View Details
Cathepsin H Antibody
OC-636-02 100 µL

Cathepsin H Antibody

Sign In for Pricing
View Details