Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 48 (TEX48)

This Recombinant Human Testis-expressed protein 48 (TEX48) spans the amino acid sequence from region 1-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 48 TEX48

UniProt

A0A1B0GUV7

Expression Region

1-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAAHQNLILKIFCLCCRDCQEPYAINDSKVPSQTQEHKPSTQNLLLQKDELDRQNPKRINAVSHLPSRTPLIQTKKSTSSSSSEFEDLNAYASQRNFYKRNLNRYCQEHWPFQPCLTGRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Piperidinyl Etonitazene
TRC-P433440-5MG 5 mg

N-Piperidinyl Etonitazene

Sign In for Pricing
View Details
Napsin A (Lung Adenocarcinoma Marker) (rNAPSA/1239), CF647 conjugate, 0.1mg/mL
BNC471880-500 1x 500 µL

Napsin A (Lung Adenocarcinoma Marker) (rNAPSA/1239), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (HPCA1/763), CF405S conjugate, 0.1mg/mL
BNC040763-500 1x 500 µL

CD34 (HPCA1/763), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Protein Lysate, Lung: left upper lobe
CP565677 150 µg

Tissue Protein Lysate, Lung: left upper lobe

Sign In for Pricing
View Details
Tauromustine
TRC-T009125-5MG 5 mg

Tauromustine

Sign In for Pricing
View Details
Rabggta Mouse Gene Knockout Kit (CRISPR)
KN514396 1 Kit

Rabggta Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details