Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human LITAF domain-containing protein (LITAD)

This Recombinant Human LITAF domain-containing protein (LITAD) spans the amino acid sequence from region 1-72. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LITAF domain-containing protein; LITAF-like protein; LITAFD

UniProt

A0A1B0GVX0

Expression Region

1-72

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MPVQAVCPYCGNRIITVTTFVPGALTWLLCTTLFLFGYVLGCCFLAFCIRSLMDVKHSCPVCQRELFYYHRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human LDH-A Recombinant Protein N-6 His Tag 50UG
IHULDHARN6HIS50UG 50 µg

Human LDH-A Recombinant Protein N-6 His Tag 50UG

Sign In for Pricing
View Details
Hsa-miR-6835-3p mimic
HY-R02234-01 5 nmol

Hsa-miR-6835-3p mimic

Sign In for Pricing
View Details
Hsa-miR-6835-3p mimic
HY-R02234-02 20 nmol

Hsa-miR-6835-3p mimic

Sign In for Pricing
View Details
PRSS37 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
37849111 3x 1.0 µg

PRSS37 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Rat sCD14 (Soluble Cluster of Differentiation 14) ELISA Kit
EKF58470 96 Tests

Rat sCD14 (Soluble Cluster of Differentiation 14) ELISA Kit

Sign In for Pricing
View Details
SHPRH Antibody
orb1324522 100 µL

SHPRH Antibody

Sign In for Pricing
View Details