Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Serine-rich and transmembrane domain-containing 2 (SRTM2), partial

This Recombinant Human Serine-rich and transmembrane domain-containing 2 (SRTM2), partial spans the amino acid sequence from region 1-37. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Serine-rich and transmembrane domain-containing 2 SERTM2

UniProt

A0A1B0GWG4

Expression Region

1-37

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MMEAHFKYHGNLTGRAHFPTLATEVDTSSDKYSNLYM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PEX1 shRNA Plasmid
abx953461-01 150 µg

Human PEX1 shRNA Plasmid

Sign In for Pricing
View Details
Human PEX1 shRNA Plasmid
abx953461-02 300 µg

Human PEX1 shRNA Plasmid

Sign In for Pricing
View Details
Angiotensin 1/2 + A (2 - 8) Acetate
orb1306227-01 2 mg

Angiotensin 1/2 + A (2 - 8) Acetate

Sign In for Pricing
View Details
Angiotensin 1/2 + A (2 - 8) Acetate
orb1306227-02 5 mg

Angiotensin 1/2 + A (2 - 8) Acetate

Sign In for Pricing
View Details
Angiotensin 1/2 + A (2 - 8) Acetate
orb1306227-03 10 mg

Angiotensin 1/2 + A (2 - 8) Acetate

Sign In for Pricing
View Details
Angiotensin 1/2 + A (2 - 8) Acetate
orb1306227-04 1 ml x 10 mM (in DMSO)

Angiotensin 1/2 + A (2 - 8) Acetate

Sign In for Pricing
View Details