Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human TATA-box-binding protein-associated factor 11-like protein 4 (TFKL4)

This Recombinant Human TATA-box-binding protein-associated factor 11-like protein 4 (TFKL4) spans the amino acid sequence from region 1-198. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TATA-box-binding protein-associated factor 11-like protein 4 TAF11L4

UniProt

A0A1W2PPE2

Expression Region

1-198

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

METGRQTGVSAEMLAMPRGLKGSKKDGIPEDLDGNLEAPRDQEGELRSEDVMDLTEGDSEASASAPPAAKRRKTHTKGKKESKPTVDAEEAQRMTTLLSSMSEEQLSRYEVCRRSAFPRARVAGLMRAITGSSVSENAAIAMAGIAKLFVGEVVEEALDVCEMWGETPPLQPKHLREAVRRLKPKGLFPNSNCKRIMF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eukaryotic Transforming Growth Factor Beta 1 (TGFb1)
TRV-0019070-01 10 µg

Eukaryotic Transforming Growth Factor Beta 1 (TGFb1)

Sign In for Pricing
View Details
Eukaryotic Transforming Growth Factor Beta 1 (TGFb1)
TRV-0019070-02 50 µg

Eukaryotic Transforming Growth Factor Beta 1 (TGFb1)

Sign In for Pricing
View Details
Eukaryotic Transforming Growth Factor Beta 1 (TGFb1)
TRV-0019070-03 100 µg

Eukaryotic Transforming Growth Factor Beta 1 (TGFb1)

Sign In for Pricing
View Details
Eukaryotic Transforming Growth Factor Beta 1 (TGFb1)
TRV-0019070-04 200 µg

Eukaryotic Transforming Growth Factor Beta 1 (TGFb1)

Sign In for Pricing
View Details
Eukaryotic Transforming Growth Factor Beta 1 (TGFb1)
TRV-0019070-05 500 µg

Eukaryotic Transforming Growth Factor Beta 1 (TGFb1)

Sign In for Pricing
View Details
Eukaryotic Transforming Growth Factor Beta 1 (TGFb1)
TRV-0019070-06 1 mg

Eukaryotic Transforming Growth Factor Beta 1 (TGFb1)

Sign In for Pricing
View Details