Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human TATA-box-binding protein-associated factor 11-like protein 9 (TFKL9)

This Recombinant Human TATA-box-binding protein-associated factor 11-like protein 9 (TFKL9) spans the amino acid sequence from region 1-198. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TATA-box-binding protein-associated factor 11-like protein 9 TAF11L9

UniProt

A0A1W2PR64

Expression Region

1-198

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

METGRQTGVSAEMLAMPRGLKGSKKDGIPEDLDGNLEAPRDQEGELRSEDVMDLTEGDSEASASAPPAAKRRKTHTKGKKESKPTVDAEEAQRMTTLLSAMSEEQLSRYEVCRRSAFPRARVAGLMRAITGSSVSENAAIAMAGIAKLFVGEVVEEALDVCEMWGETPPLQPKHLREAVRRLKPKGLFPNSNCRRIMF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FN3K Polyclonal Antibody
E-AB-90657-01 60 µL

FN3K Polyclonal Antibody

Sign In for Pricing
View Details
FN3K Polyclonal Antibody
E-AB-90657-02 120 µL

FN3K Polyclonal Antibody

Sign In for Pricing
View Details
FN3K Polyclonal Antibody
E-AB-90657-03 200 µL

FN3K Polyclonal Antibody

Sign In for Pricing
View Details
1,3-Diethyl-2-thiourea
TRC-D445293-5G 5 g

1,3-Diethyl-2-thiourea

Sign In for Pricing
View Details
MHC II (HLA-DP) (beta chain) (Bra-14), 0.2mg/mL
BNUB1129-500 1x 500 µL

MHC II (HLA-DP) (beta chain) (Bra-14), 0.2mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (KRT8/803 + KRT18/835), CF640R conjugate, 0.1mg/mL
BNC400979-100 1x 100 µL

Cytokeratin 8/18 (KRT8/803 + KRT18/835), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details