Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein PMIS2 (PMIS2), partial

This Recombinant Human Transmembrane protein PMIS2 (PMIS2), partial spans the amino acid sequence from region 1-70. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transmembrane protein PMIS2 PMIS2

UniProt

A0A1W2PS18

Expression Region

1-70

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MALKPPSATQPAPNAPATPDAPPTTGDPGASAAPGSPTTTGGPGAPAEVPQEPQEPTQTPEELAFYAPNY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITM1 ORF Vector (Human) (pORF)
20568011 1.0 µg DNA

FITM1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
GCH1 Rabbit Polyclonal Antibody
MBS9464468-01 0.05 mL

GCH1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GCH1 Rabbit Polyclonal Antibody
MBS9464468-02 0.1 mL

GCH1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GCH1 Rabbit Polyclonal Antibody
MBS9464468-03 5x 0.1 mL

GCH1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Abca1 Mouse shRNA Lentiviral Particle (Locus ID 11303)
TL509190V 500 µL Each

Abca1 Mouse shRNA Lentiviral Particle (Locus ID 11303)

Sign In for Pricing
View Details
S100A1 Rabbit Polyclonal Antibody (APC-Cy7)
orb2424003 100 µL

S100A1 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details