Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small cysteine and glycine repeat-containing protein 10 (SCGRX)

This Recombinant Human Small cysteine and glycine repeat-containing protein 10 (SCGRX) spans the amino acid sequence from region 1-105. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small cysteine and glycine repeat-containing protein 10; Keratin-associated protein 28 family pseudogene 2; SCYGR10 KRTAP28p2

UniProt

A0A286YEX9

Expression Region

1-105

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGCCGCGGCGGRCSGGCGGGCGGGCGGGCGGGCGGCGGGCGSYTTCRYYRVGCCSSCCPCCRGCCGGCCSTPVICCCRRTCRSCGCGCGKSCCQQKCCCQKQCCC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNF alpha (P/T2), 0.2mg/mL
BNUB0941-500 1x 500 µL

TNF alpha (P/T2), 0.2mg/mL

Sign In for Pricing
View Details
Phenylephrone Hydrochloride
TRC-P320670-50MG 50 mg

Phenylephrone Hydrochloride

Sign In for Pricing
View Details
ZRANB1 Mouse Monoclonal Antibody [Clone ID: OTI2A10]
CF810024 100 µg

ZRANB1 Mouse Monoclonal Antibody [Clone ID: OTI2A10]

Sign In for Pricing
View Details
CD45 / LCA Rat Monoclonal Antibody [Clone ID: IBL-5/25]
AM31886BT-N 100 µg

CD45 / LCA Rat Monoclonal Antibody [Clone ID: IBL-5/25]

Sign In for Pricing
View Details
Colloidal Gold Conjugated Goat Affinity Purified Antibody to Monkey IgG,  10nm
GAF-2305-10 1 mL

Colloidal Gold Conjugated Goat Affinity Purified Antibody to Monkey IgG, 10nm

Sign In for Pricing
View Details
Isodesmosine Chloride Hydrate (Synthetic)
TRC-I815051-10MG 10 mg

Isodesmosine Chloride Hydrate (Synthetic)

Sign In for Pricing
View Details