Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small cysteine and glycine repeat-containing protein 1 (SCGR1)

This Recombinant Human Small cysteine and glycine repeat-containing protein 1 (SCGR1) spans the amino acid sequence from region 1-88. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small cysteine and glycine repeat-containing protein 1; Keratin-associated protein 28-1; SCYGR1 KRTAP28-1

UniProt

A0A286YEY9

Expression Region

1-88

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGCCGCGGCGGCGGCGGGCGGGCGRCTTCRCYRVGCCSSCCPCCRGCCGGCCSTPVICCCRRTCSSCGYSCGKGCCQQKCCCQKQCCC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1810030O07RIK Adenovirus (Mouse)
10300054 1.0 mL

1810030O07RIK Adenovirus (Mouse)

Sign In for Pricing
View Details
NR1H2 Mouse mAb
orb2716644-01 50 µL

NR1H2 Mouse mAb

Sign In for Pricing
View Details
NR1H2 Mouse mAb
orb2716644-02 100 µL

NR1H2 Mouse mAb

Sign In for Pricing
View Details
Human Protein EMSY (EMSY) ELISA Kit
abx522007 96 Tests

Human Protein EMSY (EMSY) ELISA Kit

Sign In for Pricing
View Details
MAFG Rabbit Polyclonal Antibody (Fluoro550)
orb3105248 100 µg

MAFG Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
LYAR siRNA (Rat)
CRR4056-01 15 nmol

LYAR siRNA (Rat)

Sign In for Pricing
View Details