Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small cysteine and glycine repeat-containing protein 5 (SCGR5)

This Recombinant Human Small cysteine and glycine repeat-containing protein 5 (SCGR5) spans the amino acid sequence from region 1-85. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small cysteine and glycine repeat-containing protein 5; Keratin-associated protein 28-5; SCYGR5 KRTAP28-5

UniProt

A0A286YF46

Expression Region

1-85

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGCCGCGGCGGCGGGCGGGCGSCTTCRCYRVGCCSSCCPCCRGCCGGCCSTPVICCCRRTCCSCGCGCGKGCCQQKGCCQKQCCC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR10AE3P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
34869061 1.0 µg DNA

OR10AE3P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
AU*Anti HBcAg
SA0137 100 µL

AU*Anti HBcAg

Sign In for Pricing
View Details
5-Methoxysalicylic acid sodium
FM70008-01 500 mg

5-Methoxysalicylic acid sodium

Sign In for Pricing
View Details
5-Methoxysalicylic acid sodium
FM70008-02 1000 mg

5-Methoxysalicylic acid sodium

Sign In for Pricing
View Details
AChRα (D6) : m-IgG2b BP-HRP Bundle
sc-550037 1 Kit

AChRα (D6) : m-IgG2b BP-HRP Bundle

Sign In for Pricing
View Details
PIRC88 Protein Vector (Human) (pPM-C-HA)
36828021 500 ng

PIRC88 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details