Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Oocyte-secreted protein 4B (OSP4B)

This Recombinant Human Oocyte-secreted protein 4B (OSP4B) spans the amino acid sequence from region 14-160. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Oocyte-secreted protein 4B OOSP4B

UniProt

A0A2R8Y4Y8

Expression Region

14-160

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SDDWLLVRMKIRPFDKNTDIRIGDIHLRDNCPVTRLLSFNYAFSYPVTSCGIKKIMFQTNDDAILSEISYKPRLHTTYEFPVVCFVKRLKFPSVMHFGMSGFDAHTLKEIPQKTKGQESPTPTQSKTWTLNFNSVNKEQLSKKSLYQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C3AR1 Antibody
8G028-AAT 50 µg

C3AR1 Antibody

Sign In for Pricing
View Details
NBPF6 (NM_001143987) Human Over-expression Lysate
LY428447 100 µg

NBPF6 (NM_001143987) Human Over-expression Lysate

Sign In for Pricing
View Details
MIR509-2 Human qPCR Primer Pair (MI0005530)
HP300663 200 Reactions

MIR509-2 Human qPCR Primer Pair (MI0005530)

Sign In for Pricing
View Details
Stacking platform, small 10.5"x7.5" with dimpled mat (3.0" separation)
B3D-STACK-D 1 Each

Stacking platform, small 10.5"x7.5" with dimpled mat (3.0" separation)

Sign In for Pricing
View Details
MFluor™ Violet 540 Anti-human CD3 Antibody *UCHT1*
10032120-AAT 100 Tests

MFluor™ Violet 540 Anti-human CD3 Antibody *UCHT1*

Sign In for Pricing
View Details
FTO Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4A1]
TA809392AM 100 µL

FTO Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4A1]

Sign In for Pricing
View Details