Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Oocyte-secreted protein 4B (OSP4B)

This Recombinant Human Oocyte-secreted protein 4B (OSP4B) spans the amino acid sequence from region 14-160. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Oocyte-secreted protein 4B OOSP4B

UniProt

A0A2R8Y4Y8

Expression Region

14-160

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SDDWLLVRMKIRPFDKNTDIRIGDIHLRDNCPVTRLLSFNYAFSYPVTSCGIKKIMFQTNDDAILSEISYKPRLHTTYEFPVVCFVKRLKFPSVMHFGMSGFDAHTLKEIPQKTKGQESPTPTQSKTWTLNFNSVNKEQLSKKSLYQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ciclopirox Beta-D-Glucuronide
TRC-C432810-1MG 1 mg

Ciclopirox Beta-D-Glucuronide

Sign In for Pricing
View Details
AGXT2L1 (ETNPPL) (NM_001146627) Human Over-expression Lysate
LC431381 20 µg

AGXT2L1 (ETNPPL) (NM_001146627) Human Over-expression Lysate

Sign In for Pricing
View Details
Zavegepant (Piperazine-D8) Hydrochloride
TRC-Z252511-50MG 50 mg

Zavegepant (Piperazine-D8) Hydrochloride

Sign In for Pricing
View Details
4'-Bromo-2,2':6',2''-terpyridine
TRC-B701353-100MG 100 mg

4'-Bromo-2,2':6',2''-terpyridine

Sign In for Pricing
View Details
Human PHF20L1 activation kit by CRISPRa
GA109569 1 Kit

Human PHF20L1 activation kit by CRISPRa

Sign In for Pricing
View Details
CD239 (BCAM) (NM_001013257) Human Over-expression Lysate
LC422959 20 µg

CD239 (BCAM) (NM_001013257) Human Over-expression Lysate

Sign In for Pricing
View Details